PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676741406
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family Nin-like
Protein Properties Length: 819aa    MW: 91533.9 Da    PI: 6.2166
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676741406genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK93.91.2e-29550601152
     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  676741406 550 AEKNITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 601
                589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.12540621IPR003035RWP-RK domain
PfamPF020422.2E-25553601IPR003035RWP-RK domain
SuperFamilySSF542773.19E-22710807No hitNo description
SMARTSM006661.6E-24721804IPR000270PB1 domain
PROSITE profilePS5174527.921721804IPR000270PB1 domain
PfamPF005649.7E-18722802IPR000270PB1 domain
CDDcd064079.80E-37722798No hitNo description
Gene3DG3DSA:3.10.20.2402.1E-19722801No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MDSNSLPIDP AMDSSFMDGL LLDGCWLETT DASEFLNYSP STSIAPFDPS SFMWSPPQDT  60
AICSSGLSQM YGQDCAERSS LEDHHQGKDL SSLNRRWWIG PSGPGSSVTE RLVQAVKHIK  120
DFTSERGGSL IQLWVPVDRG GKRVLTTKEQ PFSHDPMCQR LAHYREISVN YQFSAEQEDS  180
NSSNKELVGL PGRVFLGQVP EWTPDVRFFK NEEYSRVQHA QDCDVRGTLA IPVFEQGSKI  240
CLGVIEVVMT TQMVKLSPEL ESICRALQAV DLRSTELPIS PSLKGPDFSY QAALPEIRNL  300
LRCACETHKL PLAQTWVSCL KQSKTGCRHN DENYIRCVST IDDACYVGDP TVREFHEACS  360
EHHLLKGQGV VGEAFLTNGP CFSSDVSSYK KSEYPLSHHA TMFGLHGTVA IRLRCIHTGS  420
VDFVLEFFLP KTCRDIEEQR KMLNALSTIM AHVPRSLRTV TEKELEEEGD SMASEVTERG  480
ETLPKIENTC EVHESNSNPQ NVGLVVDGGT SEMDGELGFD YGKGLSVNEN STFSSAGGFT  540
RVTEKKRTKA EKNITLDVLR QYFAGSLKDA AKNIGVCPTT LKRICRQHGI QRWPSRKIKK  600
VGHSLQKIQR VIDSVQGVSG HHLPIGSFYA NFPKLASSQE ATSLLQQQSK QTTSLPSSHS  660
QPAKSPGSSC SHSSSCSSET QVNKEDPTNK TREETMTLSR SFKETQATHL SPSTSSQDDD  720
FLRIKVSYEE EKIRFRMRNS RRLKDLLWEI AKRFSIEDVS RYDLKYLDED NEWVLLRCDD  780
DVEECVDVCR SFPGQTIKLL LQLSSQHLQE RSSVSGSLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935370.0AB493537.1 Arabidopsis thaliana At1g76350 mRNA for hypothetical protein, partial cds, clone: RAAt1g76350.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390206.10.0hypothetical protein EUTSA_v10018128mg
SwissprotQ9SFW80.0NLP5_ARATH; Protein NLP5
TrEMBLV4KCL80.0V4KCL8_EUTSA; Uncharacterized protein
STRINGAT1G76350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein